CDS

Accession Number TCMCG028C28342
gbkey CDS
Protein Id KAF6141750.1
Location join(721341..721490,721601..721690)
Organism Kingdonia uniflora
locus_tag GIB67_027928

Protein

Length 79aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA587615, BioSample:SAMN13195877
db_source JACGCM010002299.1
Definition hypothetical protein GIB67_027928 [Kingdonia uniflora]
Locus_tag GIB67_027928

EGGNOG-MAPPER Annotation

COG_category O
Description Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser Thr consensus motif in nascent polypeptide chains
KEGG_TC -
KEGG_Module M00072        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
KEGG_ko ko:K12670        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00510        [VIEW IN KEGG]
ko00513        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko04141        [VIEW IN KEGG]
map00510        [VIEW IN KEGG]
map00513        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map04141        [VIEW IN KEGG]
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0005886        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006486        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008250        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009059        [VIEW IN EMBL-EBI]
GO:0009100        [VIEW IN EMBL-EBI]
GO:0009101        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034645        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0043413        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0070085        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071944        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1901135        [VIEW IN EMBL-EBI]
GO:1901137        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1990234        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGAATGTTACAGAGTTTGGAGGATCATTGGATGTTGTTGTTGTGTTACACTTTGTTGATTCTGGTCACGATTTGATTGTTGCGGCAGATACTTCTGCTTCCAATTTGATTCAAGAGATTGCGATTGAATGCAGAGTAGACTTTGATGAGGATTCTGCTGTGATAGTCATTGGCCATACCAGTTATGCAGTATTTAAAAGTGATGGCGATCATACTTTGATTGCAAGTGATTATTTCTAG
Protein:  
MNVTEFGGSLDVVVVLHFVDSGHDLIVAADTSASNLIQEIAIECRVDFDEDSAVIVIGHTSYAVFKSDGDHTLIASDYF